PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021902-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 351aa    MW: 38768.7 Da    PI: 6.5964
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021902-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.6e-182067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++q G g+W++ +r  g++R++k+c++rw +yl
    NNU_021902-RA 20 KGPWTPEEDQKLIAYIQQNGHGSWRALPRLAGLNRCGKSCRLRWTNYL 67
                     79********************************************97 PP

2Myb_DNA-binding52.31.3e-1673118148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++   G++ W++Ia++++ gRt++++k++w+++l
    NNU_021902-RA  73 RGKFSEEEEQVILNLHSIIGNK-WSAIASHLP-GRTDNEIKNFWNTHL 118
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-251170IPR009057Homeodomain-like
PROSITE profilePS5129418.6751567IPR017930Myb domain
SuperFamilySSF466891.76E-3117114IPR009057Homeodomain-like
SMARTSM007175.9E-151969IPR001005SANT/Myb domain
PfamPF002491.6E-162067IPR001005SANT/Myb domain
CDDcd001671.43E-112267No hitNo description
PROSITE profilePS5129426.18268122IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2771122IPR009057Homeodomain-like
SMARTSM007173.9E-1672120IPR001005SANT/Myb domain
PfamPF002492.3E-1573118IPR001005SANT/Myb domain
CDDcd001674.63E-1275118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MVQWGMMGRS PCCDDNGLKK GPWTPEEDQK LIAYIQQNGH GSWRALPRLA GLNRCGKSCR  60
LRWTNYLKPD IKRGKFSEEE EQVILNLHSI IGNKWSAIAS HLPGRTDNEI KNFWNTHLKK  120
KLLKAGIDPV THKPRTDLNL LDLPRLLAVA NIDLMNPLGN ALRLQAEAAQ LARNQLLQHL  180
VQAINTSVPQ TNVEAVSLLA SAPIQGYGHA EYLAPNTQLE GPLNNPQVVP NNSSGIPNNP  240
SCPGFHHYPQ MSSEFTDSEV QQPPNDSRIL DNSVYFGGVG INGVYNPGNN NNIIISSYIN  300
TNLDGCVPPL VSTSPENERK NVSINSTALD TWGDFNLLDF NAGDNWGDMI N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30181225108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240908.10.0PREDICTED: myb-related protein 315-like
SwissprotQ8GWP01e-74MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A061EYD81e-111A0A061EYD8_THECC; Myb domain protein 107
STRINGVIT_16s0039g01710.t011e-99(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.17e-80myb domain protein 93